PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000081.1_g00015.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 342aa    MW: 37531.4 Da    PI: 8.6414
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000081.1_g00015.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1782.6e-55101371128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhPtdeel+++yL +k+++  +++ ++i +vd++k+ePwdLp k+k +ekewyfFs rd+ky+tg r+nrat++gyWk+t
  Itr_sc000081.1_g00015.1  10 LPPGFRFHPTDEELITFYLVNKISDAGFTA-RAIGDVDLNKCEPWDLPGKAKMGEKEWYFFSLRDRKYPTGVRTNRATNTGYWKTT 94 
                              79*************************999.89***************99999********************************* PP

                      NAM  87 gkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                              gkdke++++ ++elvg+kktLvfy+grap+gekt+Wvmheyr+
  Itr_sc000081.1_g00015.1  95 GKDKEIFNSsTSELVGMKKTLVFYRGRAPRGEKTNWVMHEYRI 137
                              *******9878889***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.26E-647159IPR003441NAC domain
PROSITE profilePS5100561.22310159IPR003441NAC domain
PfamPF023652.3E-2811137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MEGELKEESL PPGFRFHPTD EELITFYLVN KISDAGFTAR AIGDVDLNKC EPWDLPGKAK  60
MGEKEWYFFS LRDRKYPTGV RTNRATNTGY WKTTGKDKEI FNSSTSELVG MKKTLVFYRG  120
RAPRGEKTNW VMHEYRIHSK SSYRTNKQDE WVVCRVFQKS AGAKKYPSNH SRAVNPYTLE  180
IGPSMMSSQM IPPDHGFHFA MAAPPGRNPA AAAYITPAEM QEFNRVFRGG GGATSAAINF  240
PIHQPHQMNY PMGPPGAAGA GTGCFTISGL NLNLGGSGGS ASSQAVLRPM PPPPTPPTGM  300
AQADVLTSCE AAGYVAGDMG NPANRYMGMD QCADLDNYWP TY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-57516512171NAC domain-containing protein 19
4dul_A2e-57516512171NAC domain-containing protein 19
1ut7_B2e-57516512171NO APICAL MERISTEM PROTEIN
1ut7_A2e-57516512171NO APICAL MERISTEM PROTEIN
1ut4_B2e-57516512171NO APICAL MERISTEM PROTEIN
1ut4_A2e-57516512171NO APICAL MERISTEM PROTEIN
3swp_D3e-57516515174NAC domain-containing protein 19
3swp_C3e-57516515174NAC domain-containing protein 19
3swp_B3e-57516515174NAC domain-containing protein 19
3swp_A3e-57516515174NAC domain-containing protein 19
3swm_D3e-57516515174NAC domain-containing protein 19
3swm_C3e-57516515174NAC domain-containing protein 19
3swm_B3e-57516515174NAC domain-containing protein 19
3swm_A3e-57516515174NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00277DAPTransfer from AT2G24430Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011082111.11e-164PREDICTED: protein CUP-SHAPED COTYLEDON 3
TrEMBLA0A068VET31e-166A0A068VET3_COFCA; Uncharacterized protein
STRINGPOPTR_0018s03910.11e-160(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.21e-103NAC domain containing protein 38